PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G209700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 304aa    MW: 33854.4 Da    PI: 8.5555
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G209700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.39e-51121431128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkk...lelee.....vikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                         lppGfrFhP+d+elv +yL++k+ g         +     ++ +vd++k+ePwdLp+ +  + kewyf+s rd+kyatg+r+nrat+sgyW
  Brast07G209700.1.p  12 LPPGFRFHPRDDELVLDYLARKLVGGAaaaP---TvygcpTMVDVDLNKIEPWDLPEIACIGGKEWYFYSLRDRKYATGQRTNRATESGYW 99 
                         79********************999995541...334444699*************7666789**************************** PP

                 NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         katgkd+++ + kg lvg++ktLvfy+grapkg+kt+Wvmhe+r 
  Brast07G209700.1.p 100 KATGKDRPISR-KGLLVGMRKTLVFYQGRAPKGKKTEWVMHEFRK 143
                         *********99.999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-604166IPR003441NAC domain
PROSITE profilePS5100555.2112166IPR003441NAC domain
PfamPF023652.3E-2513142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MNNSLSMVEA RLPPGFRFHP RDDELVLDYL ARKLVGGAAA APTVYGCPTM VDVDLNKIEP  60
WDLPEIACIG GKEWYFYSLR DRKYATGQRT NRATESGYWK ATGKDRPISR KGLLVGMRKT  120
LVFYQGRAPK GKKTEWVMHE FRKEGQGDPM KLPFKEDWVL CRVFYKSRAT IAKPPIGNNY  180
NIGSAAATSL PPLIDNYIAF DHPGMSVQSL EGYEQVPCFS NNPSHPLSST SMSMNIPVTA  240
GAPTADQEQQ HVGKAIKDVL SQFSRFDQGN VKREAPPQDG VFAQDGFEYL AESGFSQMWN  300
SLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-50816711169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0275720.0HM027572.1 Triticum aestivum NAC transcription factor 7 (NAC7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563412.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE64e-90NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLI1GW570.0I1GW57_BRADI; Uncharacterized protein
STRINGBRADI1G32660.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.22e-91NAC domain containing protein 1